PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_1AL_C527C8688.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NF-YC
Protein Properties Length: 283aa    MW: 31475.2 Da    PI: 5.8621
Description NF-YC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_1AL_C527C8688.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YC60.34.1e-196851897
                  NF-YC 18 nhelPlarikkilkadedvkmisaeaPvllskacelfileltlrswlhaeenkrrtlkksdiaaavtrtdifdflvdivp 97
                           ++++P  rikki++adedv +i+  +Pvl+ska elf+ +l  r+++ + e+  +t+  s +++++ + d++dfl ++  
  Traes_1AL_C527C8688.1  6 DTRFPAPRIKKIMQADEDVGKIALAVPVLVSKALELFLQDLCDRTYNITVEKGVKTVSSSHLKQCIHSYDVYDFLKNVAS 85
                           5789***********************************************************************98765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.102.9E-25372IPR009072Histone-fold
SuperFamilySSF471132.67E-20488IPR009072Histone-fold
PfamPF008081.4E-17871IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 283 aa     Download sequence    Send to blast
MRKKLDTRFP APRIKKIMQA DEDVGKIALA VPVLVSKALE LFLQDLCDRT YNITVEKGVK  60
TVSSSHLKQC IHSYDVYDFL KNVASKVPDL GAPDSSVDDK LGKRRKHGED ESEEESKRTR  120
NEAACHTSNG RGRGRGRGRG RRAGRGAERE IEHHELGCAQ FSKPGHLKVE IGDGVLDTSE  180
TKEHTPLSNA RASLRNIDLN LDLADYEEDT VAPQVQPSAP VVTVAPQVQT SGPSVSQLKE  240
EVATKDFLGW QMPEMNKMAM DPVQFALSSN HRLEEDEDYD NEE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1jfi_A4e-22271574Transcription Regulator NC2 alpha chain
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1130139RGRGRGRGRG
2130140RGRGRGRGRGR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK2505930.0AK250593.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf92h11, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568199.11e-149PREDICTED: dr1-associated corepressor-like
TrEMBLW4ZSN40.0W4ZSN4_WHEAT; Uncharacterized protein
STRINGMLOC_72809.21e-163(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21723679
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G12480.12e-51nuclear factor Y, subunit C11
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]